Lægemiddelbehandling mod ulcerøs colitis

Doctor in Medicine, Professor, Rumyantsev V.G., Head. Institut for Kolonpatologi

Central Research Institute of Gastroenterology, Department of Health, Moskva

Ulcerøs colitis er en sygdom af ukendt etiologi med et kronisk, bølgende kursus. Dets morfologiske basis er overfladisk, diffus betændelse i slimhinden, der indledes i endetarmen og spreder sig i den proximale retning. Processen går ikke ud over tyktarmen, og derfor kan patienten lettes fra de smertefulde fornemmelser ved radikalt kirurgisk indgreb. Medikamentterapi giver dig mulighed for at kontrollere sygdomsforløbet med et acceptabelt livskvalitetsniveau. Det er opmuntrende, at forløbet af endda total colitis bliver mere gunstigt. Sværhedsgraden af ​​angreb og hyppigheden af ​​forværringer reduceres, ofte regreserer processen, begrænset til endetarmen og sigmoid kolon. Således forbliver ikke-kirurgisk behandling førende i behandlingen af ​​ulcerøs colitis. Den overfladiske natur af betændelsen og den obligatoriske involvering af endetarmen forudbestemmer tre væsentlige træk ved behandlingen af ​​sygdommen: den første er effektiviteten af ​​de "lokalt" aktive antiinflammatoriske lægemidler, især sulfasalazin og dens analoger; det andet er behovet for rektale doseringsformer, og endelig er den tredje mindre vellykket end med Crohns sygdom, effekten af ​​immunmodulerende midler. Valget af terapier er baseret på lokaliseringen og omfanget af læsionen, sværhedsgraden af ​​anfaldet, følsomheden og refraktiviteten over for visse lægemidler, den grundlæggende mulighed for at opnå remission hos denne patient.

Terapimål

Det er ekstremt vigtigt for klinikeren at forstå målet med behandlingen af ​​sygdommen under hensyntagen til de reelle muligheder for lægemiddelbehandling. Der er stadig et diskutabelt spørgsmål om muligheden for at opnå ”biologisk” remission. Så med ulcerøs colitis bevarer asymptomatiske patienter i 35-60% af tilfældene endoskopisk aktivitet, og 90% af patienterne selv med endoskopisk remission udviser histologiske tegn på betændelse, hvoraf en tredjedel er akut. Endoskopisk og histologisk remission er sent på tid. Hvornår skal behandlingen seponeres? Svaret på dette spørgsmål gives ved en retrospektiv analyse af hyppigheden af ​​forværringer. Hvis der under endoskopisk remission i løbet af året ses 4% af forværring af ulcerøs colitis, så ved vedvarende endoskopisk aktivitet - allerede 30%. Tilstedeværelsen af ​​histologiske tegn på akut betændelse øger risikoen for forværring yderligere 2-3 gange. Derfor bør man i alle tilfælde med tilbagevendende forløb af ulcerøs colitis stræbe efter histologisk remission, som er grundlaget for at stoppe behandlingen. Denne regel gælder ikke for den kronisk kontinuerlige eller aktive type sygdomme, svær akut form, patienter med hyppige forværringer. I disse tilfælde kan forlænget vedligeholdelsesbehandling og en ændring af orientering være påkrævet - for at opnå et minimalt aktivitetsniveau, hvor patienten er lettet for smertefulde symptomer og opretholder en normal livskvalitet, undgå operation eller hyppige gentagne forværringer. Fra et praktisk synspunkt er det vigtigt, at induktion af klinisk og endoskopisk remission skal være målet at behandle enhver nyligt diagnosticeret ulcerøs colitis, kronisk tilbagevendende former for sygdommen, og de kronisk aktive tilfælde, hvor behandling anses for utilstrækkelig. Hvis endoskopisk kontrol ikke er mulig, skal følgende regel anvendes: terapi udføres, indtil afføringen normaliseres og derefter i mindst 3 uger, hvilket skal være tilstrækkeligt til at opnå en endoskopisk effekt.

Mildt til moderat angreb på distal colitis

Distal ulcerøs colitis er et koncept, der inkluderer tre hovedformer af sygdommen: proctitis - en inflammatorisk proces, der strækker sig op til 20 cm fra kanten af ​​anus, proctosigmoiditis (fra 20 til 40 cm) og venstresidig colitis (40-80 cm). De udgør 60-70% af alle tilfælde af ulcerøs colitis, har vigtige træk ved patogenese, kliniske træk og behandling, der adskiller dem fra total tyktarmskade. Disse forskelle skyldes forskellig funktionel aktivitet i højre og venstre halvdel af tyktarmen, træk ved motilitet, absorption og stofskifte i tarmvæggen. Distal colitis forekommer uden systemiske komplikationer. Som et resultat af en forsinkelse af tarmindholdet over den aktive betændelseszone kommer falske ønsker med slim og blod ofte i forgrunden i det kliniske billede med konstant "traumatisering" af slimhinden med tæt afføring. Imperativ trang kan være ledsaget af anal inkontinens. Tilgængeligheden af ​​betændelseszonen for rektalt indgivne medikamenter, den høje koncentration, der er skabt af dem i tarmvæggen og lav i den systemiske cirkulation, er en forudsætning for den overvejende lokale terapi af distal ulcerøs colitis. Den kliniske effekt med rektal indgivelsesvej af lægemidler er næsten altid højere end ved oral indgivelse. Ved at manipulere administrationsvolumen og hastighed ved hjælp af forskellige doseringsformer kan du sikre levering af lægemidlet til det ønskede segment af tyktarmen. Et flydende klyster når den miltbøjning, og med et volumen på mere end 100 ml bevæger det sig videre i den proximale retning. Skum distribueres i rektum og sigmoid kolon, og suppositorier er kun begrænset til rektum.

Mange lægemidler er blevet foreslået til lokal behandling af ulcerøs colitis, men kun kortikosteroider, der virker på de "proksimale" mediatorer af den immuninflammatoriske kaskade og aminosalicylater, som også påvirker de flere, men "distale" forbindelser af patogenese, anerkendes som basale. Brug af flydende klyster fra glukokortikoider blev først foreslået i 50'erne, og deres beviste evne til at reducere den inflammatoriske respons, når de blev udsat for slimhinderne, gjorde denne terapi populær. Rektalt indgivne steroider absorberes dårligt og er derfor mere sikre end når de tages oralt. Korte kurser med rektalt indgivne kortikosteroider (prednison i en dosis på 20-40 mg / dag, hydrocortison - 100-250 mg / dag osv.) Er effektive til behandling af distal ulcerøs colitis af enhver sværhedsgrad, men de anbefales ikke at bruges kontinuerligt til at opretholde remission på grund af bivirkninger. fænomener. Og denne lille risiko er nok til at stræbe efter at bruge "systemiske" glukokortikoider til strenge indikationer. Anvendelse af 5-aminosalicylsyre (5-ASA) anerkendes som et alternativ til behandling af distal colitis. 5-ASA-præparater er lige så effektive til behandling af aktiv betændelse som glukokortikoider og overgår dem endda. De hjælper de patienter, hvis hydrocortisonterapi ikke lykkedes. Det skal bemærkes, at den effektive dosis af rektalt indgivne 5-ASA-præparater kan variere inden for store grænser - fra 1 til 4 g pr. Dag. I en dobbeltblind, kontrolleret undersøgelse hos 287 patienter blev placeboeffekten sammenlignet med 5-ASA i en dosis på 1, 2 og 4 g / 10 /. Klinisk forbedring med placebo blev opnået hos 27% af patienterne med 5-ASA i henholdsvis 67, 65 og 75%. Lægemidlet var sikkert ikke kun i traditionelle mængder, men også med en intra-intestinal injektion i en dosis på 8 g / dag. Aminosalicylater i Europa og USA betragtes som førstelinjeterapi mod ulcerøs colitis, hvorimod glucocorticoider anvendes i fravær af effekt eller allergi mod 5-ASA. Inden ordinering af systemiske steroider anvendes 2 mg / dag budesonid til klyster. Lægemidlet har en høj affinitet for hormonelle receptorer, og 90% af det omdannes til metabolitter, der er blottet for biologisk aktivitet under den første passage gennem leveren. Budesonid-klyster var sammenlignelige i induktion af remission med systemiske hormoner, men svagere end 5-ASA i en dosis på 4 g. Lægemidlet hæmmede ikke hypofyse-binyreaksen, og i kombination med mesalazin tilvejebragte en effekt, der overskred effekten af ​​hvert lægemiddel separat.

Det udelukker muligheden for at inducere remission af distal colitis ved monoterapi med sulfasalazin og dens analoger, selvom sådanne forsøg stadig ofte gøres. Dette skyldes det faktum, at orale præparater ikke skaber en terapeutisk koncentration i slimhinden i endetarmen og sigmoid colon. 5-ASA frigøres i højre kolon, og kun en lille mængde når endetarmen. En undersøgelse af koncentrationen af ​​lægemidlet i tarmslimhinden viser, at kun rektal indgivelse kan stole på effekten. Både systemiske steroider og 5-ASA kan bruges til at inducere remission af distal colitis. Alt andet lige skal du bruge det medikament, som patienten er mere følsom for, og ændre det, når der opdages resistens. Normalt manifesterer effekten sig efter 1-2 uger, men behandlingen af ​​aktiv distal colitis fortsættes i den periode, der er nødvendig for at opnå fuldstændig klinisk og endoskopisk remission - 6-8 uger. Ved et langvarigt angreb er langvarig behandling berettiget med en overgang til intermitterende indgivelse af medicin 2-3 gange om ugen. Hvis behandling med 5-ASA rektale præparater ikke fører til det ønskede resultat, kan behandlingen forbedres ved en kombination med lokale steroider eller yderligere indtagelse af 5-ASA via munden. Orale medikamenter er altid ordineret til venstresidet colitis og kan bruges til mere begrænsede læsioner for at forhindre progression af processen i den proximale retning.

Almindelig ulcerøs colitis med mild til moderat sværhedsgrad

Ved behandling af almindelig colitis med mild til moderat sværhedsgrad anvendes sulfasalazin og dets analoger oralt i kombination med lokal terapi. Hvilke 5-ASA-lægemidler foretrækkes? Hvis sulfasalazin tolereres godt, er det ikke nødvendigt at bruge "rene" 5-ASA-præparater. Bivirkninger på sulfasalazin (hovedpine, kvalme, opkast, svimmelhed) er forårsaget af toksiske koncentrationer af sulfapyridin på grund af dets langsomme eller svage acetylering i leveren. Langsomt acetylatorer lider tidligere og mere alvorligt. Særlige undersøgelser har vist, at op til 60% af befolkningen i USA er langsomme acetylatorer i USA, mens i Japan er op til 90% hurtige. Hvad angår Rusland er der ingen oplysninger om dette. Det kan antages, at en genetisk bestemt "langsom" type acetylering er mindre almindelig end i USA og Europa. Sulfasalazin anvendes i den aktive fase af sygdommen i en dosis på 4-6 g pr. Dag. Ved toksiske reaktioner begynder søgningen efter en tolereret dosis med 0,5 g, gradvist stigende i løbet af flere uger til 2 g / dag ("titrering" -metode). For de patienter, der udvikler en allergi i form af udslæt og feber, kan du begynde at tage sulfasalazin med en dosis på 1 mg og langsomt øge den i 2-3 måneder. I de senere år bruges disse teknikker sjældent på grund af en vis grad af risiko og eksistensen af ​​sikre alternative behandlingsformer. Disse inkluderer "rene" 5-ASA-præparater (Mesakol, Salofalk, Pentasa). De mangler sulfapyridin, og frigivelsen af ​​5-ASA er baseret på pH og tidsafhængige mekanismer. Mesacol frigiver 5-ASA i tyktarmen ved pH> 7, Salofalk i terminalen ileum ved pH> 6, Pentasa i hele tyndtarmen. De kan ligeledes bruges til behandling af almindelig ulcerøs colitis, selvom lægemidler med en mere distal frigivelse ser foretrukne ud. I modsætning til topisk administration af 5-ASA, hvor den dosisafhængige virkning af lægemidlet ikke er fastlagt, er orale aminosalicylater mere effektive, jo højere dosis. Sutherland et al. / 32 / udførte en metaanalyse af 8 forsøg, der involverede 1000 patienter, hvor 5-ASA og placebo blev sammenlignet i induktionen af ​​remission af ulcerøs colitis. Den dosisafhængige virkning blev bekræftet: a) mindre end 2,0 g pr. Dag, OR - 1,5; 95%; Cl 0,89-2,6; b) fra 2,0 til 2,9 g / dag, OR - 1,9; 95%; Cl - 1,3-2,8; c) mere end 3,0 g pr. dag, OR - 2,7; 95%; Cl - 1,8-3,9. Mindst 80% af patienter med moderat aktivitet af ulcerøs colitis kan reagere på 5-ASA-behandling i en dosis på 2,0-4,8 g / dag. Undersøgelser er i gang for at etablere sikre øvre dosisgrænser for 5-ASA.

Som allerede indikeret skal behandling af almindelig ulcerøs colitis kombineres orale og rektale doseringsformer. Behandlingsstrategien til anvendelse af aminosalicylater i avanceret colitis kan være ret fleksibel. Terapi begynder normalt med sulfasalazin. Der er to grunde til at overføre en patient til “rene” 5-ASA-præparater - alvorlige bivirkninger og behovet for høje doser. Hvis sulfasalazin er ineffektivt, anvendes 5-ASA-præparater med pH-afhængig frigivelse. Hvis kapslerne udskilles uændret med fæces, fungerer dette som et signal til brug af 5-ASA med en tidsafhængig coating.

Behandling af svær ulcerøs colitis

Der er intet alternativ til kortikosteroider i behandlingen af ​​alvorlige angreb på ulcerøs colitis. Parenteral administration af hydrocortison 400 mg / dag eller prednison 120 mg / dag i 5-7 dage foretrækkes normalt, hvorefter patienten overføres til oral administration med en hastighed på 1,0-1,5 mg / kg legemsvægt. Behandlingen varer 3 måneder eller mere, hvorved dosis gradvis reduceres. Hyppigheden af ​​remission nærmer sig 80%. Ved et moderat angreb af ulcerøs colitis startes behandling straks med tabletformet prednisolon. Startdosis adskiller sig fra forskellige centre. Der er mindst tre metoder til valg af dosis: den første er den minimale dosis med en gradvis stigning til den optimale, den anden er den gennemsnitlige dosis, der er tilstrækkelig for langt de fleste patienter, og til sidst bevidst overdreven, som korrigeres efter at den kliniske effekt er opnået under hensyntagen til dens hastighed offensiv. Efter vores mening er den første dosis imidlertid uacceptabel i tilfælde af alvorlig colitis, da der kræves betydelig tid for at finde en effektiv dosis, og dette er fyldt med udviklingen af ​​komplikationer og uberettigede kirurgiske indgreb. Reduktion af den "overvurderede" dosis kan være langsom eller hurtig. Fra en dosis på 30 mg / dag tilsættes aminosalicylater, som efterlades som en vedligeholdelsesbehandling efter corticosteroid tilbagetrækning. For at forhindre osteoporose ordineres patienterne calcium- og vitamin D-præparater. Om nødvendigt overføres patienten til parenteral eller enteral ernæring, vandelektrolytforstyrrelser korrigeres, antibakteriel terapi med metronidazol, cephalosporiner eller ciprofloxacin.

Brug af orale aminosalicylater på samme tid som høje doser af steroider til svær ulcerøs colitis understøttes ikke af følgende grunde: 1) de er svagere end glukokortikoider af deres antiinflammatoriske virkning; 2) aminosalicylater reducerer responsen på steroider; 3) bivirkninger, der opstår, når du tager aminosalicylater, kan forværre forløbet af colitis og derfor simulere resistens.

Hvad angår pulsbehandling og korte hormonbehandlingskurser, er der ingen konsensus. Måske den vellykkede anvendelse af pulsbehandling med methylprednisolon i en dosis på 1 g / dag eller dexamethason i en dosis på 100 mg / dag i form af 3-dages infusioner. Imidlertid er korte hormonbehandlingskurser for at afbryde anfaldet kun effektive under udseendet af de første tegn på forværring hos alvorlige patienter med inflammatoriske tarmsygdomme. I dette tilfælde fortsættes behandling med høje doser af steroider i højst 10-14 dage med overgangen til intermitterende hormoner eller aminosalicylater. Dette er den periode, hvor hormonbehandling kan afbrydes uden "abstinenssyndrom." Dette er naturligvis kun muligt hos unge patienter i mangel af alvorlige samtidige sygdomme og tidligere langvarig hormonbehandling.

Kontinuerlig ulcerøs colitis og hormonafhængighed

Der er en kategori af patienter, som selv med tilstrækkelig behandling ikke kan opnå vedvarende forbedring eller remission, som har brug for konstant vedligeholdelsesbehandling. Disse kan være patienter med distal eller udbredt colitis med forskellige aktivitetsgrader. Blandt dem er patienter med hormonafhængighed. Under hormonafhængighed betragtes det som manglende evne til at reducere dosis af prednisolon under 10 mg / dag uden at forværre sygdommen eller et udbrud af processen inden for 3 måneder efter ophør af hormonbehandling / 7 /. I dette tilfælde er der fire muligheder: brug af blidt intermitterende hormonindtagelse, overførsel til aktuelle steroider, brug af azathioprin / methotrexat eller infliximab.

Intermitterende hormonindtagelse er lånt fra pædiatrisk praksis. Det blev vist, at den optimale dosis er at tage 40 mg prednison hver anden dag. Ved denne dosis blev de bedste resultater og minimale bivirkninger observeret. Der blev ikke observeret nogen undertrykkelse af hypofyse-binyreaksen, hvilket gjorde det muligt at stoppe behandlingen på samme tid uden frygt for ”abstinenssyndrom”. Denne ordning var vellykket hos patienter med hyppige forværringer og kronisk kontinuerlig sygdomsforløb. Der er udviklet to metoder til at skifte fra det basale forløb af hormonbehandling: ved at overføre 1 tablet (5 mg) prednisolon fra en dag til en anden hver 10. dag eller ved at reducere dosis med 5 mg for hver anden dag med et interval på 6-10 dage. Den første metode var mere pålidelig og mindre tilbøjelige til at genaktivere.

Overførsel af en patient til aktuelle steroider (budesonid) kan også undgå farlige bivirkninger. Litteraturdata indikerer, at systemiske steroider kan reduceres eller annulleres hos 2/3 af de hormonafhængige patienter. Det skal huskes, at budesonid i den anbefalede dosis (9 mg / dag) svarer til 30 mg prednisolon. De ordineres på samme tid og reducerer derefter gradvist systemiske steroider, indtil de er helt annulleret.

Meget oftere anvendes immunosuppressiva, især azathioprin, til behandling af hormonafhængige former for inflammatorisk tarmsygdom. Analyse af mere end 20 års erfaring med hormonafhængig ulcerøs colitis viste, at induktion af remission med samtidig steroidudtrækning er mulig hos 40-80% af patienterne. Terapi med azathioprin fortsættes i 4 år eller mere. Det skal dog huskes, at lægemidlets virkning er forsinket og forekommer ikke tidligere end 3 måneder. Derfor er det vigtigt at bruge en passende dosis azathioprin (2,0-2,5 mg / kg) og varighed (mindst 6 måneder). Lægemidlet er relativt sikkert, men hos mennesker med genetisk lav thiopurin-methyltransferase-aktivitet kan leukopeni og sepsis udvikle sig. Azathioprin-behandling er kontraindiceret i dem. Heldigvis er monozygot lav thiopurinmethyltransferase-aktivitet sjælden - kun i 0,3% af tilfældene. Yderligere 11,1% bemærkede heterozygot eller mellemaktivitet, hvilket krævede en dosisreduktion på 50%.

Hvis effekten ikke er tilstrækkelig, skal du benytte dig af udnævnelsen af ​​methotrexat. Dette er en analog dehydrofolinsyre, som i lave doser udviser immunmodulerende egenskaber. Det er vist, at methotrexat i en dosis på 25 mg / uge IM eller SC er effektiv til at inducere og opretholde remission af Crohns sygdom. Imidlertid kan det anvendes med succes i nogle tilfælde af ulcerøs colitis. Bivirkninger er relativt små. Brugen af ​​methotrexat er begrænset af den teratogene virkning, hepatotoksicitet og muligheden for at udvikle leverfibrose ved langvarig brug. Lægemidlet kan bruges oralt i form af 5 mg tabletter hver anden dag, men biotilgængeligheden af ​​oral methotrexat varierer markant. Denne administrationsmetode er kun egnet under opretholdelse af remission..

Med behandlingssvigt, intolerance over for disse immunsuppressive medikamenter eller behovet for en hurtig respons, er infliximab blevet brugt i de senere år. Indførelse af iv infliximab i en dosis på 5 mg / kg kan stoppe de aktive manifestationer af sygdommen og gentagne infusioner hver 8. uge - for at understøtte remission. Infliximab har en sparringseffekt på glukokortikoider. Det anbefales at bruges hele året som monoterapi eller i kombination med azathioprin..

Hormonal modstand

Hormonal resistens er det mest alvorlige problem klinikere har at gøre med. Tolkning af begrebet ”resistens” er især vanskeligt ved ulcerøs colitis. Så i et alvorligt angreb etableres resistens efter de første 5 dage af intensiv hormonbehandling og i distale former - efter 6-8 ugers behandling - 5-ASA indad og lokalt - med steroider. Udseendet af hormonel resistens er meget uklart. Nogle beskriver et reduceret niveau af receptorer kun hos resistente patienter, andre - alt sammen uden undtagelse i sammenligning med kontrollen. Corticosteroid receptorer har udtryk for enten en aktiv alfa-kæde eller det modsatte beta. Sidstnævnte bestemmes nøjagtigt med hormonstabilitet / 1 /. Patienter med ulcerøs colitis med et højt niveau af antineutrofil cytoplasmatiske antistoffer viser refraktoritet. Derudover kan forøget ekspression af multidrug-resistensgenet, der er påvist i de perifere lymfocytter hos patienter med inflammatoriske sygdomme i tyktarmen, der kræver operation / 8 / være betydelig..

Ved ulcerøs colitis efter 5 dages mislykket iv kortikosteroidbehandling ordineres cyclosporin. Det er et kraftfuldt immunsuppressivt middel med en selektiv effekt på den T-lymfocytiske immunrespons, som hæmmer transkription og dannelse af IL-2 og interferon-gamma. Den stigende anvendelse af cyclosporin i klinisk praksis bekræfter nytten af ​​en sådan behandling. Kolektomi undgås normalt hos 40-69% af patienterne. Protokollen til anvendelse af cyclosporin tilvejebringer start af behandling med iv-infusion i en dosis på 2-4 mg / kg og opretholdelse af en blodkoncentration på højst 500 ng / ml i 7-10 dage. Derefter overføres patienten til medikamentet inde i en dosis på 5-8 mg / kg og kontrollerer koncentrationen i et niveau på ca. 300 ng / ml. Det blev senere vist, at en lignende virkning kan opnås ved anvendelse af oral mikroemulsionscyklosporin i en dosis på 5 mg / kg med høj biotilgængelighed. Behandlingen fortsættes i 3 måneder, hvor den kombineres med udnævnelsen af ​​azathioprin, som efterlades som vedligeholdelsesbehandling. Normalt er de bange for veletablerede bivirkninger af cyclosporin (nedsat nyrefunktion, hypertension) og kontrollerer blodtrykket, nyre- og leverfunktionen og overvåger blodkoncentrationen. Vores erfaring med brug af neoral bekræfter cyclosporins evne til at overvinde hormonresistens med god langtidseffekt hos 64% af patienterne. Koncentrationen af ​​cyclosporin i blodet varierede fra 80 til 170 ng / ml, og under ingen omstændigheder blev behandlingen afbrudt på grund af farlige bivirkninger. Efter vores mening er oral cyclosporin et ret sikkert og effektivt lægemiddel til behandling af svære former for ulcerøs colitis, som kan bruges i bred klinisk praksis som et alternativ til kirurgi.

Med resistente former for Crohns sygdom bruges et nyt middel - infliximab. Disse er kimære monoklonale antistoffer mod tumor nekrose faktor. Dets vigtigste virkningsmekanisme er forbundet med neutraliseringen af ​​dette pro-inflammatoriske cytokin på cellemembraner og induktion af apoptose af aktiverede T-celler. Den første erfaring med brugen af ​​infliximab hos patienter med ulcerøs colitis lod ikke en endelig konklusion drages om lægemidlets effektivitet til opnåelse af remission af sygdommen, overvinde hormonafhængighed og resistens. To offentliggjorte store randomiserede forsøg vippede imidlertid skalaerne til fordel for infliximab / 24, 29 /. I disse undersøgelser fik 364 patienter, der ikke svarede på mindst en af ​​standardbehandlingerne (inklusive orale 5-ASA-lægemidler), infliximab i doser på 5 mg / kg, 10 mg / kg eller placebo. Efter et tredobbelt regime med induktionsterapi efter 0, 2 og 6 uger fik han gentagne infusioner hver 8. uge. Ikke kun klinisk, men også endoskopisk remission blev opnået hos 60-62% af patienterne med infliximab i en dosis på 5 mg / kg efter 8 uger sammenlignet med 31-34% med placebo (P

Hvis du har ulcerøs colitis - en diæt er ikke nok

Hvordan man identificerer en alvorlig sygdom, og hvilke foranstaltninger der er nødvendige for at holde den under kontrol

"Ubehageligt i maven" - så patienter taler delikat om de første manifestationer af ulcerøs colitis. Og allerede i en ærlig samtale med lægen taler de i detaljer om årsagerne til ubehag, symptomer, der i stigende grad begynder at genere... Og det viser sig, at en alvorlig sygdom længe har sendt sine "signaler", og folk ignorerede dem og forværrede smerterne.

Om, hvordan ulcerøs colitis manifesteres, hvor farlig den er, og hvordan den behandles med moderne medicin, siger Vladimir Pilipenko, Ph.D., forsker ved Institut for Gastroenterologi og Hepatologi i klinikken ved Institut for Ernæring.

- Vladimir Ivanovich, hvad der kan kaldes de mest åbenlyse tegn på ulcerøs colitis?

- En person forekommer ineffektiv, den såkaldte falske trang til at affæle, der er urenheder af slim og pus i fæces. Træthed bekymrer en person, en generel sygdom kan forekomme. Karakteriseret ved udseendet af mavesmerter, der intensiveres før afføring og aftager efter det. Nedsat appetit, vægttab, feber kan være med.

- Over tid intensiveres symptomerne?

- Ja, uden behandling øges sværhedsgraden af ​​symptomer, nye tilslutter sig, som begynder at genere patienten allerede om natten, hvilket øger risikoen for komplikationer markant.

- Hvordan diagnosticeres ulcerøs colitis??

- Den vigtigste diagnostiske metode forbliver koloskopi. For denne sygdom er der meget karakteristiske ændringer i tarmslimhinden, som er godt påvist af endoskopet. Selv når symptomerne på sygdommen går tilbage, fortsætter ændringer i slimhinden i lang tid, og de tjener som kriterier for sygdommens forekomst og effektiviteten af ​​behandlingen. I uklare tilfælde, hvor det ikke er muligt at foretage en koloskopi, ledes lægerne af et sådant blodantal som C-reaktivt protein og niveauet af calprotectin i fæces.

- Er der sygdomme, der ligner ulcerøs colitis, der skal udelukkes inden behandling?

- Sygdommens begyndelse skal skelnes med infektiøse læsioner i tarmen. For at gøre dette, så fæces for at identificere mulige patogener. Og alligevel - med aterosklerotiske forstyrrelser i blodforsyning til tarmen hos ældre. Til dette er en røntgenundersøgelse af tarmen, en biopsi ordineret. For at udelukke en anden alvorlig sygdom i mave-tarmkanalen - Crohns sygdom, ordineres også en biopsi. Hæmorroider bestemt ved rektoskopi.

Brugen af ​​folkemiddel mod ulcerøs colitis er farlig. Tilstrækkelig behandling, der påbegyndes sent, kan være ineffektiv, og læger vil blive tvunget til at fjerne tyktarmen for at redde patientens liv..

- Hvilke andre sygdomme ledsager ofte denne sygdom??

- Ikke-specifik ulcerøs colitis er meget mere almindelig hos patienter med primær skleroserende cholangitis - dette er en autoimmun læsion i galdekanalen.

- Arvelighed spiller en rolle?

- Ja, patientens pårørende er 15 gange mere tilbøjelige til at få ulcerøs colitis.

- Populære artikler taler ofte om allergiske og autoimmune faktorer, der kan udløse en sygdom...

- Vi ved med sikkerhed, at sygdommen er forbundet med en ændring i immunresponset mod tarmens mikroflora. Men dette kan ikke kaldes hverken en klassisk allergi eller en autoimmun proces..

- Er det i tilfælde af allergiske reaktioner, er det tilstrækkeligt at identificere allergener og undgå dem?

- Indtil videre har det ikke været muligt at finde ud af, nøjagtigt hvilken komponent i floraen eller produktet af deres vitale aktivitet, der påvirker immuniteten. Derfor er spørgsmålet om den faktor, der forårsager sygdommen, åbent..

- Hvis vi taler om sygdommens autoimmune mekanisme - er det fornuftigt at styrke immunforsvaret?

- Det antages, at på grund af en ændring i mikrofloraens sammensætning eller mængde (det er endnu ikke klart, hvorfor dette sker), ophører immunsystemet med at genkende tarmbakterier som normalt og begynder at bekæmpe dem. Viden om immunsystemets funktion er ikke nok til at forudsige konsekvenserne af interferens i dets arbejde. Ja, du kan prøve at styrke et link til immunsystemet, men dette vil svække resten af ​​dets forbindelser. Beslutningen om interventioner i immunsystemet skal træffes af en læge, der er klar over alle konsekvenserne af en sådan intervention..

- Hvad kan anbefales som forebyggelse af ulcerøs colitis?

- De stærkeste faktorer, der påvirker tarmens mikroflora, forbliver antibiotika såvel som diætregimet og sammensætningen. Brug ikke antibakterielle lægemidler uden god grund, og du bør konsultere en ernæringsspecialist.

- Stress, mental overbelastning kan forårsage forværringer?

- Der er en sammenhæng mellem sygdommens indtræden og følelsesmæssig stress, men der er stadig få data til specifikke anbefalinger. Forekomsten i de seneste årtier vokser, og det skyldes sandsynligvis en ændring i strukturen og sammensætningen af ​​befolkningens ernæring.

- Kan det holde sygdommen tilbage??

- Diæt er en hjælpebehandlingsmetode, der giver dig mulighed for at opnå en hurtigere begyndelse af remission af sygdommen. Men uden lægemiddelbehandling i optimale doseringer er diæt ineffektiv.

- Vladimir Ivanovich, det er sandt, at ulcerøs colitis er lettere for rygere?

- Rygere er mindre tilbøjelige til at blive syge, det er sandt. Men hvis de er syge, adskiller sygdomsforløbet sig ikke fra ikke-ryger. Og hvis en ikke-ryger patient tændes, føler han sig ikke bedre, det er helt sikkert.

- Stemmer det, at mennesker med denne sygdom har en større risiko for at udvikle kræft i tarmen??

- Hos patienter med ulcerøs colitis er risikoen for at udvikle kræft højere, men dets implementering kræver år: mere end 8 år med total læsion og mere end 15 år med venstresidet colitis. Derfor skal processen overvåges ved regelmæssig koloskopi. Hvis ulcerøs colitis ikke behandles, er risikoen for andre formidable komplikationer stor - perforering af tarmen, vaskulær trombose, giftig ekspansion af tarmen, tarmblødning.

- Hvad tilbyder moderne medicin som behandling? Er der et gennembrud i behandlingen af ​​ulcerøs colitis i de senere år?

- Hovedbehandlingen forbliver medicin 5-aminosalicylsyre og glukokortikosteroider, der bruges i henhold til særlige ordninger. Selv i mangel af sygdomsmanifestationer bør patienter tage vedligeholdelsesdoser af 5-ASA. De reserverede lægemidler forbliver immunsuppressive lægemidler. I øjeblikket er der en intensiv undersøgelse af nye behandlingsmetoder - dette er antistoffer mod tumor nekrose faktor, transplantation af tarmfloraen hos raske individer. Men mens disse metoder er i udviklingsstadiet af metodikken.

- Hvor ofte har jeg brug for at se en læge med denne diagnose?

- I begge tilfælde ordinerer lægen en individuel plan for besøg og kontrolundersøgelser. Ved remission af sygdommen udføres endoskopisk overvågning to gange om året..

- Er der en chance for at leve lykkeligt nogensinde med ulcerøs colitis?

- Prognosen for sygdommen er ret kompliceret, det afhænger af omfanget og graden af ​​tarmskader, tilstedeværelsen af ​​komplikationer. Det er meget vigtigt - tidspunktet for påbegyndelse af behandlingen og dets tilstrækkelighed, patientens forpligtelse til den ordinerede medicin og diæt. Og det er bare disse faktorer, der kun afhænger af ham selv.

Hvis ulcerøs colitis ikke behandles, er risikoen for andre formidable komplikationer stor - perforering af tarmen, vaskulær trombose, giftig ekspansion af tarmen, tarmblødning.

Produkter, der kan konsumeres med ulcerøs colitis (se infographic):

- afkok og gelé fra blåbær, fuglekirsebær, kvæde, pærer, løvtræ;

- stærk te, især grøn;

- rød druemostvin

- mos, korn, især semulje og ris;

- produkter af hakket magert kød, dampet eller kogt i vand (soufflé, dumplings, potetmos, koteletter) "

- kogt fisk med lavt fedtindhold uden hud *.

* Alle måltider og drikkevarer skal indtages i en varm form. Du kan ikke spise kolde retter (under 15-17 ° C), især når de konsumeres på tom mave eller som første retter - dette er is, drikke, rødbeder, okroshka, kolde geléretter. Drik ikke stærk kaffe, helmælk.

Produkter, der ikke kan konsumeres med ulcerøs colitis:

- tørrede frugter (svisker, tørrede abrikoser og figner);

- korn (perlebyg, byg, boghvede, havregryn, hirse);

- marmelade, honning, sirup;

- saltet fisk, røget kød, konserverede snacks;

- saltede, syltede, syltede grøntsager;

- gærede mælkedrikke med høj surhedsgrad;

- kvass, frugtdrikke, hvide druemostvine;

- creme fraiche, fløde, vegetabilske olier, æggeblommer.

Alderskategori af materialer: 18+

Ikke-specifik ulcerøs colitis

Hvad er ulcerøs colitis??

Ikke-specifik ulcerøs colitis er en sygdom i mave-tarmkanalen, nemlig tyktarmen, kendetegnet ved den inflammatoriske proces i dens slimhinde..

Som et resultat af denne betændelse dannes sår og necroseområder i dele af tarmen. Sygdommen er kronisk og har en tendens til at gentage sig igen..

Oftest påvirker patologien den unge befolkning, mennesker i alderen 15 til 30 år. Mindre ofte udvikler de første angreb på sygdommen sig efter 50 år. Statistikker viser, at ud af 100 tusind af befolkningen gennemsnitligt 70 mennesker bliver syge. Derudover er kvinder mere sandsynligt diagnosticeret end mænd..

Den patologiske proces fanger ikke tyndtarmen og påvirker kun visse dele af tyktarmen og ikke hele dens overflade. Det manifesterer sygdommen enten i endetarmen eller i sigmoid colon, det vil sige i slutningen af ​​tyktarmen. Så er der en yderligere spredning af den inflammatoriske proces.

Kan kur i ulcerøs colitis??

Om, hvorvidt der er mulighed for at kurere ulcerøs colitis, tænker enhver, der er diagnosticeret med en sådan sygdom. De sygdomme, der klassificeres som kroniske, kan ikke helbredes fuldstændigt. Ulcerøs colitis henviser specifikt til sådanne sygdomme. Men dette betyder ikke, at du helt skal opgive den terapeutiske effekt.

Sygdommen kan og bør kontrolleres ved at vælge den optimale eksponeringstaktik sammen med den behandlende læge. Dette skal gøres, da patologien er kendetegnet ved cyklisk, dvs. perioder med remission erstattes af perioder med forværring. Hvis du ignorerer tilstedeværelsen af ​​colitis i lang tid, truer dette udviklingen af ​​komplikationer, endda død. Terapi og diæt hjælper med at begrænse sygdommen og forhindrer gentagne angreb. Derfor med en ordentlig behandling krænkes ikke kvaliteten og forventet levetid for en person med ulcerøs colitis. Vedvarende remission kan observeres i årevis..

Symptomer på ulcerøs colitis

Sygdommens symptomatologi afhænger af, hvor nøjagtigt den patologiske proces er lokaliseret og af dens intensitet. Derudover er det værd at skelne mellem tarm- og ekstraintestinale manifestationer..

Tarmsymptomer inkluderer:

Forekomsten af ​​diarré, hvori urenheder i blodet opdages. Ofte er der foruden blodpropper også slim og pus til stede i afføringen, hvilket giver dem en ildelugtende lugt. Det sker, at der vises blod med slim og pus mellem afføring. Hyppigheden af ​​afføring varierer afhængigt af sygdommens sværhedsgrad og kan nå op til 20 gange om dagen. En person kan miste op til 300 ml blod pr. Dag. Med et mildere forløb af sygdommen, defecerer en person flere gange, oftere om morgenen og natten timer.

Smertesymptomer varierer også i styrke. De kan være enten skarpe, binde udtrykte ubehag eller svage og ikke forårsage alvorlig lidelse for en person. Nogle gange er det ikke muligt at slippe af med smertefulde fornemmelser, selv ved hjælp af medicin, hvilket indikerer udviklingen af ​​en komplikation af sygdommen. Stedet for lokalisering af smerter er venstre side af maven eller den venstre iliac-region. Som regel forekommer intensivering af smerte inden defækation, og efter det aftager de noget. Smerter kan også få styrke efter at have spist.

Kropstemperaturforøgelse, men normalt ubetydelig, op til subfebrile mærker.

Generel forgiftning af kroppen med samtidige tegn, herunder udseendet af svaghed, svimmelhed, udvikling af depression, nedsat humør, forekomsten af ​​irritabilitet og tåreværn. Patientens appetit falder, og derfor begynder han at tabe sig, hvilket i nogle tilfælde fører til anoreksi. Intoxikation er karakteristisk, hvis sygdommen er alvorlig.

Tenesmus eller falsk trang til at tømme tarmen. I nogle tilfælde frigives enten slim eller slimhindemasse i stedet for fæces.

Fækal inkontinens.

Ændring af diarré til forstoppelse. En lignende overgang er et tegn på, at en markant betændelse er begyndt at udvikle sig i slimhinden, der forder tyktarmen.

Nogle gange kan ulcerøs colitis udvikle sig hurtigt. Denne form for sygdommen kaldes fulminant og vil blive diskuteret nedenfor..

Ud over tarmsymptomer lider patienten af ​​ekstraintestinale læsioner:

Udviklingen af ​​erythema nodosum (dannelse af subkutane knuder detekteret ved palpation), gangrenøs pyoderma (nekrose i hudområdet). Dette skyldes øget cirkulation i blodet af bakterier og immunkomplekser produceret til at bekæmpe dem. Derudover bemærkes hudlæsioner såsom fokal dermatitis, urticarial og post-ulcerøs udslæt..

Oropharynx-nederlaget, der forekommer hos 10% af patienterne. Dette kommer til udtryk i fordelingen af ​​aphthae, der passerer efter det er muligt at opnå remission. I mundhulen, glossitis og tandkødsbetændelse kan ulcerøs stomatitis begynde at udvikle sig..

Øjesygdomme observeres endnu sjældnere, ikke mere end hos 8% af patienterne. Patienter kan lide af iridocyclitis, uevitis, choroiditis, konjunktivitis, keratitis, retrobulbar neuritis og panophthalmitis.

Fælles læsioner, der udtrykkes i gigt, spondylitis, sacroileitis. Desuden er disse læsioner i det artikulære væv ofte forløberne for ulcerøs colitis..

Oftere end andre systemer gennemgår lungerne patologiske processer..

Som et resultat af funktionsfejl i den endokrine kirtel, funktionsfejl i leveren, galleveje, bugspytkirtel.

Meget sjældent klager patienter over myositis, osteomalacia, osteoporose, vaskulitis, glomerulonephritis.

Tilfælde af udvikling af autoimmun thyroiditis og hæmolytisk anæmi er blevet beskrevet..

De første tegn på ulcerøs colitis

For ikke at forveksle sygdommens begyndelse med andre lignende patologier i tarmkanalen, skal du have en idé om, hvad de første tegn på colitis kan være.

Der er flere muligheder for udvikling af sygdommen:

For det første kan diarré udvikle sig i starten, og efter nogle få dage findes blod og slimhindemasse i afføringen.

For det andet kan rektal blødning åbne umiddelbart efter manifestationen af ​​den inflammatoriske proces. Stolen vil ikke være flydende, men dekoreret eller en grødlignende konsistens.

For det tredje kan patienten lide af diarré, forgiftning og rektal blødning samtidigt.

Oftest begynder sygdommen gradvist at udvikle sig med diarré, som er forårsaget af udviklingen af ​​omfattende betændelse i tarmslimhinden. På baggrund af denne proces bliver det ude af stand til at absorbere natrium og vand igen. Blod vises til gengæld på grund af det faktum, at der dannes mavesår på membranen, hvilket danner løst bindevæv, der trænger gennem det vaskulære netværk. Symptomerne er tilbøjelige til at aftage og derefter få fart igen..

Ud over diarré kan de første tegn på sygdommens begyndelse være smerter, der hovedsageligt forekommer på venstre side og en svag stigning i kropstemperatur. En person kan opleve smerter i leddene, da skader på deres væv i nogle tilfælde går forud for udviklingen af ​​sygdommen.

Så de fire tidlige tegn, som du skal være opmærksomme på, og som gør det muligt for en person at mistænke ulcerøs colitis på egen hånd, er: diarré med blod, ledsmerter, ubehag i maven og feber.

Årsager til ulcerøs colitis

Sygdommens etiologi er stadig et åbent spørgsmål, og forskere søger stadig efter årsagerne til dens udvikling..

Imidlertid er risikofaktorer, der har en provokerende virkning på udviklingen af ​​den patologiske proces i tyktarmen, pålideligt kendt:

Genetisk disponering. Risikoen for, at en nær slægtning i blodet lider af sygdommen øges markant, hvis der er lignende tilfælde af ulcerøs colitis i familien.

Sygdommens infektiøse natur. Tarmen er en del af kroppen, hvor et stort antal bakterier er koncentreret. Nogle af dem på et tidspunkt kan føre til betændelse..

Autoimmune mekanismer, der forekommer i kroppen. Denne idé blev ansporet af forskere om, at ulcerøs colitis er forbundet med sæsonbestemte forværringer, egner sig godt til behandling med hormonelle medikamenter. Undersøgelser har bekræftet, at jo hårdere processen i tarmen er, desto mere forværres ændringerne i immunstatus.

Krænkelse af diæt, fejl i menuen.

Stress og andre traumatiske faktorer.

Forskere konkluderer, at denne sygdom afhænger af mange faktorer, som hver har en bestemt effekt på dannelsen af ​​ulcerøs colitis. Den førende rolle hører sandsynligvis til tarmantigener. Som bevis på denne teori kan føre en stor undersøgelse udført af amerikanske forskere, hvis resultater blev offentliggjort i Los Angeles Times. Forskere var i stand til eksperimentelt at etablere en forbindelse mellem svampe placeret i tarmen og ulcerøs colitis.

I øjeblikket i teorien om sygdomspatogenesen tildeles den førende rolle to faktorer: immun og genetisk bestemt.

Former af ulcerøs colitis

Det er sædvanligt at skelne adskillige former for sygdommen, som afhænger af stedet og graden af ​​lokalisering af den inflammatoriske proces i tyktarmen samt af sygdommens art og intensitet.

Afhængig af lokaliseringen af ​​betændelse skelner de således:

Venstresidig colitis. Denne form er forskellig, idet tyktarmen påvirkes. Symptomer begynder med diarré, hvor der er urenheder i blodet. Smerterne er lokaliseret på venstre side, appetitten forsvinder, hvilket fører til degeneration.

Samlede prik. Denne form for sygdom betragtes som den mest livstruende, da den truer udviklingen af ​​komplikationer, især dehydrering, trykfald, hæmoragisk chok. Symptomer på sådan colitis manifesteres i form af smerter med høj intensitet, vedvarende rigelig diarré, massivt blodtab.

Pankolitis, kendetegnet ved betændelse i endetarmen i hele dens længde.

Distal colitis. Denne form for colitis er kendetegnet ved inddragelse i den patologiske proces af membranen i venstre tarm, dvs. sigmoid og rektum på samme tid. Det er distal colitis, der er udbredt. Symptomer manifesteres i skarpe smerter, hovedsageligt lokaliseret i venstre iliac-region, tenesmus, sekretion af slim og blodstrimler i afføringen, flatulens og undertiden forstoppelse.

Proctitis, hvor kun endetarmen påvirkes.

Afhængigt af egenskaberne ved sygdomsforløbet er der:

Kronisk kronisk colitis.

Fulminant eller akut colitis.

Kronisk tilbagevendende colitis.

Kronisk ulcerøs colitis

Kronisk ulcerøs colitis er kendetegnet ved, at tarmsmembranen er hyperemisk, det vaskulære mønster gennemgår en ændring, erosion og atrofiske formationer findes langs dens linje.

Det vigtigste symptom på kronisk ulcerøs colitis er en langvarig forstyrrelse i afføringen, der i forværringsperioden stiger op til 15 gange om dagen. Diarré giver også plads til forstoppelse.

Derudover er en konstant ledsager af kronisk colitis mavesmerter, der får en monoton karakter. I perioder med remission klager patienterne over øget gasdannelse, der rumler i maven. Vægttab observeres dog ikke, appetitten er som regel ikke forstyrret..

Ofte har sådanne mennesker neurologiske lidelser, især træthed, irritabilitet, hyperhidrose. Maven er hævet, på lægekontoret, under palpation, bemærkes moderat smerte i visse dele af tyktarmen.

Forværring af ulcerøs colitis

En forværring af sygdommen er kendetegnet ved en voldsom manifestation af alle symptomer. Afføringen bliver hyppigere, den indeholder urenheder i blod og slim. Elektrolytforstyrrelser øges hurtigt, i mangel af behandling udvikler dehydrering.

Det er farligt at ignorere den akutte ulcerative proces i tyktarmen, da den truer med komplikationer. Blandt dem udvikling af arytmi (på grund af mangel på magnesium og kalium), hævelse (på grund af et fald i blodets onkotiske tryk midt i et fald i proteinet i blodet), hypotension, svimmelhed, nedsat syn, forgiftning af kroppen.

Derudover er fulminant eller fulminant form af colitis en særlig fare, hvilket endda kan føre til brud på tyktarmen og indre blødninger.

Diagnose af ulcerøs colitis

Hvis en person har mistanke om, at han udvikler ulcerøs colitis, skal du søge lægehjælp. En læge eller en gastroenterolog kan diagnosticere sygdommen..

For en nøjagtig diagnose kræves en laboratorietest, herunder:

Generel blodanalyse. I henhold til dens resultater diagnosticeres anæmi og en stigning i antallet af leukocytter..

En biokemisk blodprøve, hvor C øges - et reaktivt protein, der indikerer tilstedeværelsen af ​​en inflammatorisk proces. Antallet af gamma-globuliner vil stige, det kvantitative indhold af magnesium, calcium og albumin vil falde.

En immunologisk blodprøve, der vil påvise væksten af ​​antistoffer (cytoplasmatisk antineutrofil).

Analyse af fæces, hvor blod, slim og pus vil være til stede.

Endoskopi, der inkluderer koloskopi og rektosigmoskopi, vil indikere tilstedeværelsen af:

Purulente, slim- og blodudskillelser i tarmen;

Når endoskopi udføres i perioden med remission af sygdommen, observeres atrofi af slimhindens foring i tarmen.

Glem ikke røntgenundersøgelsen. I denne sygdom bruges en bariumblanding til at skabe kontrast. I henhold til resultaterne fra røntgen kan patienten se polypper, ulcerationer, et fald i tarmen, hvis nogen.

Forskere udvikler en ny type undersøgelse - kapselendoskopi, som i nogle tilfælde kan erstatte koloskopi. Denne procedure er smertefri og medfører ikke ubehag, visualisering med den er imidlertid værre end ved en direkte undersøgelse af tarmen.

Konsekvenserne af ulcerøs colitis

Konsekvenserne af ulcerøs colitis, som blev diagnosticeret sent, kan være ganske alvorlige:

Hvis hele kolonet påvirkes, er der i de næste par år en risiko for tyktarmskræft.

Derudover er der en risiko for colonperforering, som kan være dødelig..

Sygdommen medfører ofte, at der dannes revner i tarmen, tarmblødning.

Giftig megacolon er en anden komplikation af sygdommen, der består i udvidelse af tarmen i det berørte colitis-område. Processen ledsages af kraftig smerte, feber og generel svaghed..

Behandling af ulcerøs colitis

Behandling af sygdommen er symptomatisk, da der ikke er nogen måde medicinsk at påvirke årsagen til betændelse. Derfor kommer de mål, som læger stræber efter at nå, ned for at lindre betændelse, forhindre alvorlige komplikationer og etablere en tilstand af vedvarende remission.

Konservativ behandling af sygdommen er:

I overensstemmelse med kosten. Når sygdommen er i den akutte fase, er patienten fuldstændigt begrænset i mad, og kun vand tilbydes som kilde til drikke. Når den akutte fase er afsluttet, skal patienten skifte til en proteindiet med et lavt fedtindhold. Prioriteten vil være æg, cottage cheese, magert kød og mager fisk. Grov fiber er heller ikke egnet til spisning, da det kan skade irriteret tarmslimhinde. Kilden til kulhydrater findes i en række korn, frugtbaserede kompoter osv. I særligt vanskelige tilfælde overføres patienten til kunstig ernæring.

Da afvisning af friske frugter og grøntsager truer med vitaminmangel, anbefales patienten at tage vitamin-mineralkomplekser.

Indtagelse af ikke-steroide antiinflammatoriske lægemidler, herunder mesalazin, sulfasalazin, salofalk.

Foreskriv kortikosteroid hormonelle medikamenter, men med ekstrem forsigtighed. Dette skyldes, at de kan forårsage nogle alvorlige komplikationer, især osteoporose, hypertension. Dette er lægemidler såsom prednison, methylprednisolon.

Terapi med antibakterielle midler: cyfran, ciprofoxalin, ceftriaxocon.

Symptomatiske medikamenter, der er nødvendige for at lindre smerter, stoppe diarré og øge jernniveauer i blodet, hvis der er anæmi.

Der er fysioterapeutiske metoder til at påvirke sygdommen. Blandt dem blev der vist særlig effektivitet: SMT (moduleret strømeksponering), diadynamisk terapi, interferensbehandling og andre.

Når konservative metoder ikke giver den ønskede effekt i kampen mod sygdommen, tager lægerne ind for kirurgisk indgreb.

Indikationer for operation for ulcerøs colitis er:

Moderne aspekter af behandlingen af ​​ulcerøs colitis hos børn

Hvorfor er ulcerøs colitis et medicinsk og socialt problem? Hvad er principperne for behandling? I den tiende udgave af den internationale klassificering af sygdomme betegnes denne sygdom som ulcerøs colitis (ikke-specifik), kode K51 - "nekrotiserende

Hvorfor ulcerøs colitis er et medicinsk og socialt problem?
Hvad er principperne for behandling?

I den tiende udgave af den internationale klassificering af sygdomme betegnes denne sygdom som ulcerøs colitis (ikke-specifik), kode K51 - "nekrotiserende betændelse i slimhinden i tyktarmen og endetarmen, kendetegnet ved forværring".

Den højeste alder for sygdommens begyndelse forekommer i det andet og tredje årti af livet, men sygdommen observeres både hos spædbørn og ældre [4]. Ikke-specifik ulcerøs colitis (ULC), kendetegnet ved et progressivt forløb og forårsager en række komplikationer, er derfor et stort socialt problem, da det krænker barnets livsstil og fører til tidlig handicap. Alt dette indikerer sværhedsgraden af ​​sygdommen..

På trods af almindeligheden i mange terapeutiske tilgange, bestemmer barnets fysiologiske udvikling og forskellene i det kliniske forløb af UC hos børn og voksne såvel som utilstrækkelig erfaring med brugen af ​​moderne lægemidler i børns praksis, forskellen i tilgange til behandling af børn og voksne.

Konservativ behandling af UC hos børn er baseret på følgende principper:

  • diætterapi;
  • baseterapi med 5-aminosalicylsyrepræparater og / eller glukokortikoider (systemiske og lokale effekter);
  • antibakterielle midler;
  • cytostatika (immunsuppressiva);
  • immunmodulatorer;
  • symptomatisk ("ledsagende") terapi.

Behandling af UC hos børn skal være omfattende, skal du sørge for nøje at overholde dagsordenen og ernæring. En vigtig betingelse for at behandle børn på et hospital er at skabe en atmosfære af fysisk og mental fred for dem. Med en tilfredsstillende tilstand og velvære vises kun begrænsningen af ​​udendørs spil. Nødvendig ro går i den friske luft. Med en betydelig krænkelse af den generelle tilstand, feber, udmattelse, metaboliske ændringer osv., Bør behandlingen være sengeleje.

Ernæring

Når NAC ordineres mekanisk og kemisk skånsom kost med et højt indhold af protein, vitaminer, mælk er udelukket, er mængden af ​​fiber begrænset. Nogle gange kan selv den mindste krænkelse af kosten hos børn føre til en forværring af tilstanden. Streng slankekur er især vigtig i nærvær af sekundært malabsorptionssyndrom..

I det akutte stadium er frugter og grøntsager udelukket. Granatæble juice er tilladt, og granatæble skræl tørres og bruges i afkogninger som en astringent. Afkok og gelé fra tørre blåbær, fuglekirsebær, saft af aronia, solbær er almindeligt anvendt.

Derudover anbefales den såkaldte "astronaut-mad", der består af de mest raffinerede, næsten ingen yderligere enzymatiske spaltningsprodukter. Til dette formål anvendes en elementær diæt (isokal, cosylat, enshur, nutrichim, renutril osv.). Disse lægemidler bruges også til enteral rørernæring. Denne diæt er specielt indiceret til patienter med tarmfistler eller nedsat tålmodighed samt til børn, der er forkrøblede [4].

De fleste børn med UC har en markant proteinmangel på grund af proteintab, malabsorption, anorexia og vitaminmangel, hvilket fører til mangel på kropsvægt. Derfor, med enhver form og fase af sygdommen, bør fødevarer være lige så mange kalorier, hovedsageligt på grund af protein.

Det er meget vigtigt at udelukke yderligere sensibilisering af patienter med madallergener, derfor anbefales en allergivenlig (eliminering) diæt: ekstraaktive stoffer, æg, chokolade, kakao, kaffe, citrusfrugter, jordbær, jordbær, røde æbler, boller, industrielle konservesprodukter er forbudt, individuel intolerance bør også overvejes madvarer.

Da krydsallergi er muligt (børn med allergi mod komælk kan opleve en allergisk reaktion på oksekød), anbefales det ofte at udelukke oksekød fra kosten [3].

Diæt med NNC er kun mindre streng, hvis der opnås remission.

Parenteral ernæring til børn ordineres til svær UC. Til dette formål skal du bruge sådanne infusionsopløsninger som alvezin, aminosol, aminopeptid, vamin, caseinhydrolysat kombineret med glucose og polyioniske opløsninger..

5-aminosalicylsyrepræparater (5-ASA)

Grundlaget for den basale terapi for UC er 5-aminosalicylsyre (5-ASA) eller salicylater.

I årenes løb har sulfasalazin, hvis aktive bestanddel er 5-ASA, forblevet det foretrukne lægemiddel til behandling af UC..

5-ASA hæmmer aktiviteten af ​​neutrofil lipoxygenase og syntesen af ​​arachidonsyremetabolitter (prostoglandiner og leukotriener), som bliver formidlere af inflammation. Det hæmmer migrationen, degranuleringen og fagocytosen af ​​neutrofiler såvel som sekretionen af ​​immunoglobuliner med lymfocytter, hæmmer produktionen af ​​frie iltradikaler og er deres inaktivering [1, 4, 11]. 5-ASA virker også på overfladeceptorer af epitelceller, transport af elektrolytter og permeabilitet af tarmepitel. Derudover påvirker 5-ASA adhæsionsmolekyler, kemotaktiske peptider og inflammatoriske mediatorer (eicasanoider), blodpladeaktiverende faktor, cytokiner [4, 11].

Foruden 5-ASA inkluderer sulfasalazin også sulfapyridin, et inert stof, der sikrer levering af 5-ASA til tyktarmen, som er den direkte årsag til hyppigt forekommende bivirkninger. Behandling med sulfasalazin i 10-30% af tilfældene ledsages af udviklingen af ​​bivirkninger: gastrointestinale manifestationer (anorexia, kvalme, opkast, smerter i det epigastriske område); almindelige symptomer (hovedpine, feber, svaghed, arthralgi); hæmatologiske lidelser (agranulocytose, pancytopeni, anæmi, hæmoragisk syndrom); tegn på skade på forplantningssfæren osv. [1, 6, 8].

Sulfasalazin blokerer konjugering af folinsyre i børstens kant af jejunum, hæmmer transporten af ​​dette vitamin, hæmmer aktiviteten af ​​enzymatiske systemer, der er forbundet med det i leveren, derfor bør folsyre i en aldersdosis inkluderes i komplekset af terapeutiske foranstaltninger til patienter med ulcerøs colitis behandlet med sulfasalazin.

Sulfasalazin ordineres 3 gange dagligt efter måltider: til børn under 5 år - 1-3 g pr. Dag, fra 6 til 10 år gamle - 2-4 g, over 10 år gamle - op til 5 g, afhængigt af sygdommens sværhedsgrad. Når staten stabiliseres, falder dosis gradvist - først med 1/3, efter 2 uger i fravær af forringelse - med endnu 1/3. Den minimale dosis, hvorpå patientens tilstand stabiliseres, bestemmes; vende tilbage til den forrige dosis ved forværring.

Hyppigheden af ​​komplikationer, når du tager sulfasalazin, er blevet grundlaget for udviklingen af ​​nye lægemidler, der ikke indeholder sulfapyridin, såsom mesalazin. For at lægemidler kan komme uændret ind i tyktarmen, er de dækket med specielle membraner. Der er tre typer lignende stoffer. De førstnævnte er 5-ASA belagt med acrylgummi (clavierzal, salofalk, asacol, rovaz), derfor opdeles sådanne præparater kun ved pH = 6-7, hvilket er karakteristisk for tyktarmen. Fremstillingen af ​​pentas (5-ASA indkapslet i ethylcellulose) begynder at virke selv ved pH> 4,5 i tyndtarmen. Pentasa ordineres med en hastighed på 20-30 mg / kg pr. Dag.

Den anden type medikamenter er azoforbindelserne i to 5-ASA-molekyler, som spaltes i tyktarmen af ​​bakterieenzymet azoreduktase (olsalazin). Den tredje type er den ikke-absorberbare polymer 5-ASA (balsalazid).

Et antal 5-ASA-præparater er tilgængelige ikke kun i form af tabletter, men også i form af klyster og suppositorier, f.eks. Færdige pentaser og salofalk suppositorier, mikroclysterskum, der anvendes rektalt til distale tyktarmsskader. Der fremstilles også stearinlys med sulfasalazin (sulfasalazin og kakaosmør) og mikroclyster med sulfasalazin (sulfasalazintabletter og destilleret vand).

Salofalk-tabletter indeholder 250 mg eller 500 mg mesalazin og ordineres i en dosis på 500-1500 mg / dag (30-50 mg / kg). Derudover bruges lægemidlet i form af suppositorier (250 mg, 500 mg) 1-2 gange om dagen, som klyster (2 g / 30 ml og 4 g / 60 ml) 1-2 gange om dagen.

Mesacol (tabletten indeholder 400 mg 5-ASA) er ordineret i en dosis på 400-1200 mg / dag, afhængigt af barnets kropsvægt og sværhedsgrad af UC.

Ved anvendelse af 5-ASA-præparater bemærkes i nogle tilfælde en dosisafhængig effekt, der tvinger en stigning i dosis af lægemidlet til at opnå remission. Vedligeholdelsesbehandling (halvdelen af ​​den ordinerede terapeutiske dosis) udføres i lang tid, hvilket tillader opnåelse af stabil remission og reducerer risikoen for tyktarms-malignitet [9]. Når der udføres vedligeholdelsesbehandling fra 6 måneder til et år, reduceres dosis hver 2. uge til 1/4 tablet og bringes til 1/2 / 1/4 tablet (generel blod- og urinprøve en gang hver anden uge).

Ved langvarig brug af sulfasalazin (vedligeholdelsesbehandling) tages bivirkninger af lægemidlet, primært hepatotoksicitet, i betragtning [6, 11].

I foråret og efteråret gennemføres anti-tilbagefaldskurser med 5-ASA-præparater (0,25-0,5-1 g en gang dagligt, afhængigt af alder).

Hormonbehandling

Glukokortikoider (GC) indtager et førende sted i behandlingen af ​​svære former for UC. Dette skyldes for det første, at 5-ASA-præparater ikke altid er effektive til behandling af denne sygdom. For det andet giver brugen af ​​HA en relativt hurtig positiv effekt, som er forbundet med deres antiinflammatoriske og immunsuppressive egenskaber.

Indikationer for hormonbehandling - akut sygdomsforløb; alvorlige former; moderate former (hvis et 2-ugers behandlingsforløb med aminosalicylater var ineffektivt); kroniske former, der er vanskelige at behandle ved andre metoder; systemiske (ekstraintestinale) manifestationer (polyarthritis, uveitis, hepatitis, høj feber); intolerance over for aminosalicylater [1, 7, 15].

I tilfælde af NAC bruges følgende: lokalt (rektal indgivelse); systemisk - lave doser, høje doser, skiftevis terapi, pulsbehandling, kombinationsterapi (med 5-ASA, cytostatika).

Typisk varierer dosis af HA (prednison, methylprednisolon) fra 1 til 2 mg / kg. Oprindeligt er den daglige dosis af lægemidlet opdelt i tre doser, derefter skifter de til en enkelt dosis om morgenen.

Med god tolerance for prednisolon anbefales det at indgive terapi i den ordinerede dosis, indtil det ønskede resultat er opnået (inden for 3-4 uger), hvorefter dosis reduceres trinvist - med 10 mg hver 5-7 dag. Startende med 1/2 af den indledende dosis, anbefales en enkelt dosis prednison om morgenen, som praktisk talt ikke medfører alvorlige komplikationer. Reduktion af dosis af prednison til 1/3 af den indledende dosis udføres gradvist, 5 mg hver 7-10 dage i 2-2,5 måneder. Et komplet hormonterapi tager 10 til 20 uger, afhængigt af UC-formen.

Hvis der kræves et langt kursus, er det muligt at skifte til en skiftevis behandlingsregime med HA-terapi, der består i at ordinere korttidsvirkende HA uden udtalt mineralocorticoid aktivitet en gang om morgenen (ca. 8 timer), hver 48 timer (hver anden dag). Målet med skiftevis (årti) terapi er at reducere sværhedsgraden af ​​bivirkninger af HA, samtidig med at den terapeutiske effekt opretholdes [5].

I svære former for UC observeres ”hormonafhængighed”, når hormonabsorbering fører til en forværring af sygdommen. I sådanne tilfælde ordineres det skiftende regime med HA-terapi i lang tid inden for 3-6-8 måneder.

Under svære former for UC anvendes undertiden impulsbehandling, som involverer intravenøs indgivelse af store doser HA en gang dagligt i tre dage (ofte er methylprednisolon det valgte lægemiddel).

Foruden prednison anvendes metipred, frataget uønsket mineralocorticoid aktivitet. Dosisforholdet for prednison-metipred er 5: 4.

Med et fald i dosis af prednisolon med halvdelen ordineres sulfasalazin eller 5-ASA i minimumsdosis (1/3 af den terapeutiske dosis). Derefter øges dosis af 5-ASA, og med fuldstændig afskaffelse af hormoner bringes den maksimale (terapeutisk dosis), valgt afhængigt af alder (1-2 g pr. Dag). Når remission opnås, kan dosis af 5-ASA reduceres til en vedligeholdelsesdosis (1/2 terapeutisk dosis).

I tilfælde af distale læsioner i tyktarmen ordineres prednison i form af mikroclyster og suppositorier (mikroclyster er fremstillet af prednisolon-tabletter og destilleret vand, og lys fremstilles af prednisolon-tabletter og kakaosmør). Med succes anvendt "dråbe" mikroclyster med hydrocortison (hydrocortison og destilleret vand), hvis doser afhænger af barnets kropsvægt og sygdommens sværhedsgrad.

Brugen af ​​kortikosteroider er forbundet med udviklingen af ​​en række komplikationer (immunsuppression, osteoporose, hyperglykæmi, Cushings syndrom, stunting, mavesår, hypertension osv.). Desuden er ildfaste former for inflammatorisk tarmsygdom mere og mere almindelige, hvis behandling med hjælp af glukokortikoider ikke giver den forventede effekt.

I de senere år er hormoner med "lokal" handling (enterocort, budenofalk, budesonid) blevet udviklet og er vidt brugt i klinisk praksis (især med hormonresistente former). De er kendetegnet ved høj affinitet for hormonelle receptorer og en præsystemisk metabolisme. Som et resultat minimeres bivirkninger [4, 15].

Budesonid er en lokal, potent, ikke-halogen glukokortikoid med antiinflammatoriske, anti-allergiske, anti-ekssudative og dekongestante egenskaber. Fordelen med lægemidlet er, at det har en lokal virkning og på grund af dårlig absorption såvel som hurtig metabolisme ikke har systemiske virkninger. Høj affinitet for hormonelle receptorer i slimhinden i tyktarmen forbedrer den lokale terapeutiske virkning af budesonid (budenofalk). På grund af dets kemiske sammensætning er budesonid stærkt lipofilt; det er i stand til at trænge fremragende gennem cellemembraner og distribuere i væv, hurtigt gennemgå lever- og ekstrahepatisk metabolisme. En gradvis dosisreduktion er ikke påkrævet, da abstinenssyndrom ikke forekommer [4, 15].

Antibakterielle midler

Antibiotika til UC anvendes kun i henhold til indikationerne: efter kirurgisk behandling, hos febile patienter med septiske komplikationer, med toksisk udvidelse af tyktarmen [13]. Anvendes ofte i lange trichopolum (metronidazol) i en dosis på 10-20 mg / kg pr. Dag. Om nødvendigt ordineres cephalosporiner med antibiotika.

immunosuppressiva

Immunsuppressiva (cytostatika) er ordineret til børn meget sjældent på grund af det store antal bivirkninger [2]. Spørgsmålet om deres anvendelse opstår kun i tilfælde af ineffektivitet af kortikosteroider og i det kontinuerlige sygdomsforløb. I UC, især når det kommer til hormonresistente former, ordineres 6-mercaptururin, azathioprin, methotrexat, cyclosporin osv. Fra immunsuppressiva [12, 14].

I sin kemiske struktur og biologiske virkning er azathioprin tæt på mercktopurin, har cytostatisk aktivitet og har en immunsuppressiv virkning. Sammenlignet med mercebookurin er lægemidlets immunsuppressive virkning imidlertid relativt stærkere med en lidt lavere cytostatisk aktivitet..

Azathioprine ordineres i en dosis på 100 mg pr. Dag i 9-12 måneder, begynder at virke inden den 3. måned.

Methotrexat er en metabolit og folsyre-antagonist. Det forstyrrer syntesen af ​​purin nukleotider, forstyrrer syntesen af ​​DNA og RNA, hæmmer celledeling og vækst og forårsager deres død. I tilfælde af NUC administreres lægemidlet intramuskulært i en dosis på 25 mg en gang om ugen i 12 uger.

Cyclosporin udøver en selektiv effekt på T-lymfocytter, hæmmer reaktioner af cellulær og humoral immunitet og betragtes i øjeblikket som en backup-metode, når andre behandlingsformer er ineffektive..

immunmodulatorer

Mekanismen for virkning af immunmodulerende lægemidler i UC er forbundet med undertrykkelse af aktiviteten af ​​naturlige dræber og funktionen af ​​cytotoksiske T-lymfocytter.

Det er bevist, at brugen af ​​immunmodulatorer af thymalin og tactivin i den komplekse behandling af patienter med UC hjælper med at korrigere tilstanden af ​​immunologisk ubalance, især eliminerer manglen på T-linket til immunitet, normaliserer hjælperundertrykkelsesforhold og immunreguleringsindekset, hvilket fører til eliminering af den inflammatoriske proces, da det fjerner autosensitisering og øger kroppens forsvar.

Inflammatorisk tarmsygdom vides at være kendetegnet ved overdreven produktion af antiinflammatoriske cytokiner. For nylig har der været rapporter om brugen af ​​bioteknologiske lægemidler, der kan undertrykke betændelse [10, 16]. Der lægges særlig vægt på to molekyler: interleukin-1 og tumor nekrose faktor (TNF-a), da de på nuværende tidspunkt er de vigtigste mål for antiinflammatorisk terapi ved forskellige sygdomme. I 2001 blev der registreret en ny generation af lægemiddelinfliximab (remicade) i vores land, som er et monoklonalt antistof mod tumornekrosefaktoren. Remicade har øget antiinflammatorisk aktivitet.

Symptomatisk ("ledsagende") terapi

Angioprotectors, enterosorbenter, intestinale antiseptika, antidiarrealer, enzymer, biologi, vitaminer, mineraler, beroligende midler, urter ordineres som ekstra terapi, der sigter mod at normalisere fordøjelsesprocesserne og øge kroppens immunreaktivitet..

For at forbedre mikrocirkulation anvendes parmidin (0,125-0,25 mg 3 gange om dagen) og trental (0,05-0,15 mg 3 gange om dagen) for angioprotektorerne.

Ofte er der behov for udnævnelse af enterosorbenter (polyfepan, carbolen), hvis mest lovende er enterosgel, algisorb, SUMS, vaulin.

Hos børn anvendes tarmantiseptika fra quinolinserien (Intestopan, Intetrix, Entero-Sediv) og nitrofuran-serien (Furazolidone, Ercefuril)..

Med vedvarende diarré ordineres indhyllings- og astringente midler (almalox), som dog skal bruges meget omhyggeligt. Til samme formål ordineres undertiden atropinholdige antidiarrémidler (reasec-lomotil, der inkluderer kodein og atropin; lægemidlet har ikke kun antidiarré, men også en antispasmodisk virkning), lispafen (atropinsulfat og diphenoxinhydrochlorid). I de senere år har imodium været mere populær (har en opioideffekt). Langvarig brug af dette medikament i UC er fyldt med forekomsten af ​​toksisk dilatation af tyktarmen.

Sandostatin, der påvirker absorptionen af ​​vand og elektrolytter i tyndtarmen, reducerer koncentrationen af ​​vasoaktive peptider i blodet, reducerer hyppigheden af ​​tarmbevægelser og fæces, er et nyt og lovende lægemiddel.

Af enzympræparaterne til NJC anvendes mezim forte, creon, liqurease, pancreatin.

Hidtil er det mest lovende brugen af ​​stoffet Creon 10000. Det opfylder alle krav til moderne enzympræparater: Creon 10 000 er kendetegnet ved den optimale kvalitative sammensætning af enzymer i fysiologisk forhold, er modstandsdygtig over for syre, størrelsen på lægemidlets minimikrospherer sikrer dens ensartede blanding med mad og på samme tid chympassage gennem portvagteren. Ved indtræden i maven opløses en kapsel indeholdende minimikrofer inden for 1-2 minutter. Mere end 90% enzymaktivitet opnås efter 45 minutter ved en pH på mere end 5,5. Creon 10000 er et sikkert lægemiddel og kan bruges i alle grupper af patienter, uanset køn og alder..

Da i UC-tilfælde repræsenterer slimhinden i tyktarmen en gunstig jord til udvikling af dysbiose, er det ofte nødvendigt at ordinere biologik. Med et fald i normal flora ordineres bifidumbacterin, lactobacterin, bificol. Metronidazol påvirker anaerob flora (clostridia, bakteroider), medicin af nitrofuran-serien er effektive til protean dysbiosis.

Du kan ordinere klyster med præparater af natriumsalte af propionsyre og smørsyre samt pantothensyre (en forløber for koenzym) for at regulere metabolismen af ​​epitelceller i tyktarmen og for at normalisere metabolismen af ​​colonocytter.

Alle patienter skal modtage et kompleks af vitaminer - kalium- og calciumpræparater, et kompleks af sporstoffer og jernmangelanæmi - jernpræparater.

I tilfælde af UC bruges præparater af brom, valerian rod, oreotel, glycin, novopassit osv. Til at berolige centralnervesystemet..

Urtemedicin (kamille, johannesurt, hemophilus, kolgan osv.) Er en af ​​komponenterne i den komplekse behandling af UC hos børn.

Astringenter bruger også astringenter: almindelig eg (bark), perforeret johannesurt (græs), grå uld (kegler), fuglekirsebær, almindelige blåbær (frugter), almindelig kvæde (frugt, frø), almindelig granatæble (skræl) og en medicinsk blodstivelse ( rødder); hæmostatisk: kolgan, hæmofili, bjergbestigende peber (græs), dioica brændenælde (blade), uld, markhestetræk (græs) osv..

Ovenfor er behandlingsregimen for UC afhængigt af sygdommens sværhedsgrad.

Problemet med kirurgisk behandling af UC er stadig ikke løst. Der er meget blandede meninger om palliative og radikale operationer samt tidspunktet og omfanget af rekonstruktive operationer..

Operationen (kolektomi) udføres i henhold til nødsituationsindikationer (perforering af tarmen eller dens trussel, massiv blødning) såvel som med udviklingen af ​​karcinom i den berørte tarm. Ofte er en indikation for kirurgisk indgreb et langt, udmattende forløb i colitis, især væksthæmning, der udviklede sig på baggrund af en mislykket intensiv medicinsk terapi.

Den mest almindelige kirurgiske behandling for UC er subtotal colonresektion med en ileosigmoid. Efter 10-12 måneder, når tilstanden er stabiliseret, udføres rekonstruktive operationer - påføring af en anastomose mellem ileum og endetarm eller sigmoid kolon, samt dannelse af et tyndtarmsreservoir.

Litteratur
  1. Zlatkina A.R. Behandling af kroniske sygdomme i fordøjelsessystemet. M., 1994.S. 163-217.
  2. Kanshina O. A. Erfaring i behandling af ulcerøs colitis hos børn og unge // Pediatrics. 1992. Nr. 1. S. 78-82.
  3. Levitan M. Kh., Fedorov V. D., Kapuller L. L. Ikke-specifik colitis. M., 1980.S. 201-205.
  4. Loginov A.S., Parfenov A.I. tarmsygdomme. M., 2000.S. 32.
  5. Nosonov E. L. Generelle egenskaber og virkningsmekanismer for glukokortikoider // Brystkræft. 1999. Nr. 8. T. 7 P. 364-371.
  6. Paykov V. L. Farmakoterapi i pædiatrisk gastroenterologi. Skt. Petersborg, 1998, 188-189.
  7. Ryss V.S., Fishson-Ryss Yu. I. Nogle træk ved det kliniske billede og behandling af ulcerøs colitis og Crohns sygdom // Ter. arkiv. 1990. Nr. 2. s. 25-32.
  8. Frolkis A.V. Moderne farmakoterapi i gastroenterologi. St. Petersborg, 2000. 56-57, 62.
  9. Eaden J. A., Abrams K., Mayberry J. F. Den sande risiko for kolorektal kræft i ulcerøs colitis: en metaanalyse // Castroenterology. 1999. Vol. 116. P. A398.
  10. Evans R. S., Clarce I., Heath P. et al. Behandling af ulcerøs colitis har en konstrueret human anti-TNF-a antistof CD P571 // Aliment Pharmacol Ther. 1997. s. 1031-1035.
  11. Hanacur S. B. Inflammatorisk tarmsygdom // N. Engl. J. Med. 1996. Vol. 334. S. 841-848.
  12. Kirschner B. S. Sikkerhed hos Azathioprine og 6-Mercaptopurine pædiatriske patienter har betændelse i tarmen // Gastroenterologi. 1998. Vol. 115. s. 813-821.
  13. Prantera C., Scribano M. L., Berto E. Antibiotikum bruger Crohns sygdom: Hvorfor og hvordan? Bio Drugs, 1997. Vol. 8. s. 293-306.
  14. Reimund J. M., Duclos B., Baumann R. Cyclosporin-behandling mod svær ulcerøs colitis Syv tilfælde // Ann Med Int. 1997. Vol. 148. s. 527-529.
  15. Rutgeerts P. Medicinsk behandling af inflammatorisk tarmsygdom // Fordøjelse. 1998. Vol. 59. s. 453-469.
  16. Worcester S. Biologisk agent lovende for børn med Crohns sygdom // Nyheder om børn. 1999. Vol. 33. S. 8.

Bemærk!

Konservativ behandling af UC hos børn er baseret på følgende principper:

  • diætterapi;
  • baseterapi med 5-aminosalicylsyrepræparater og / eller glukokortikoider (systemiske og lokale effekter);
  • antibakterielle midler;
  • cytostatika (immunsuppressiva);
  • immunmodulatorer;
  • symptomatisk ("ledsagende") terapi.

Det Er Vigtigt At Vide Om Diarré

En tarmsvamp er en af ​​de mest almindelige fordøjelsesforstyrrelser, hvor der er en stigning i antallet af bakterier og gær på tarmvæggen og en krænkelse af den kvantitative balance mellem mikroorganismer i tarmen.

Lidt om normer og overtrædelserAciditet er forskellig i forskellige organer i fordøjelseskanalen. Dette er et komplekst system på grund af den forskellige struktur og funktioner i slimhinderne i hver afdeling.